SCOPe 2.08: Domain d2y9he1: 2y9h E:1-87

Lineage for d2y9he1 (2y9h E:1-87)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.53: Ferredoxin-like domains from CRISPR-associated proteins [117987] (8 families)

5. Family d.58.53.0: automated matches [231597] (1 protein)
   not a true family

6. Protein automated matches [231598] (4 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [231599] (3 PDB entries)

8. Domain d2y9he1: 2y9h E:1-87 [231600]
   Other proteins in same PDB: d2y9ha2, d2y9ha3, d2y9hc2, d2y9he2, d2y9he3, d2y9hg2, d2y9hg3, d2y9hi2, d2y9hi3, d2y9hk2, d2y9hk3, d2y9hm2, d2y9hm3, d2y9ho2, d2y9ho3
   automated match to d1wj9a1
   protein/RNA complex

Details for d2y9he1

PDB Entry: 2y9h, 2.5 Å

PDB Description: structure a of crispr endoribonuclease cse3 bound to 19 nt rna

PDB Compounds: (E:) cse3

SCOPe Domain Sequences for d2y9he1:

Sequence; same for both SEQRES and ATOM records:

>d2y9he1 d.58.53.0 (E:1-87) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mwltklvlnpasraarrdlanpyemhrtlskavsraleegrerllwrlepargleppvvl
vqtltepdwsvldegyaqvfppkpfhp

Timeline for d2y9he1:

• d2y9he1 first appeared in SCOPe 2.03
  
• d2y9he1 appears in SCOPe 2.07