Lineage for d2y32d_ (2y32 D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2415301Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2415932Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 2415933Protein automated matches [190537] (10 species)
    not a true protein
  7. 2415955Species Bradyrhizobium japonicum [TaxId:375] [228284] (2 PDB entries)
  8. 2415963Domain d2y32d_: 2y32 D: [231594]
    automated match to d4bbod_

Details for d2y32d_

PDB Entry: 2y32 (more details), 1.78 Å

PDB Description: crystal structure of bradavidin
PDB Compounds: (D:) blr5658 protein

SCOPe Domain Sequences for d2y32d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y32d_ b.61.1.0 (D:) automated matches {Bradyrhizobium japonicum [TaxId: 375]}
qsvnwtwtnqygstlaitsfnsntgaitgtytnnaanscdegkpqgvtgwlaygntgtai
sfsvnflgcgsttvwtgqlnnatgfqglwylslaeavawngisagadtftfssgdkallt
ksgvdlkagseklsntk

SCOPe Domain Coordinates for d2y32d_:

Click to download the PDB-style file with coordinates for d2y32d_.
(The format of our PDB-style files is described here.)

Timeline for d2y32d_: