Lineage for d2y32a_ (2y32 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2806418Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 2806419Protein automated matches [190537] (10 species)
    not a true protein
  7. 2806441Species Bradyrhizobium japonicum [TaxId:375] [228284] (2 PDB entries)
  8. 2806446Domain d2y32a_: 2y32 A: [231591]
    automated match to d4bbod_

Details for d2y32a_

PDB Entry: 2y32 (more details), 1.78 Å

PDB Description: crystal structure of bradavidin
PDB Compounds: (A:) blr5658 protein

SCOPe Domain Sequences for d2y32a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2y32a_ b.61.1.0 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 375]}
qsvnwtwtnqygstlaitsfnsntgaitgtytnnaanscdegkpqgvtgwlaygntgtai
sfsvnflgcgsttvwtgqlnnatgfqglwylslaeavawngisagadtftfssgdkallt
ksgvdlkagseklsntk

SCOPe Domain Coordinates for d2y32a_:

Click to download the PDB-style file with coordinates for d2y32a_.
(The format of our PDB-style files is described here.)

Timeline for d2y32a_: