SCOPe 2.08: Domain d2y0ja_: 2y0j A:

Lineage for d2y0ja_ (2y0j A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)

8. Domain d2y0ja_: 2y0j A: [231590]
   automated match to d3wi2a_
   complexed with axc, mg, zn

Details for d2y0ja_

PDB Entry: 2y0j, 2.43 Å

PDB Description: triazoloquinazolines as a novel class of phosphodiesterase 10a (pde10a) inhibitors, part 2, lead-optimisation.

PDB Compounds: (A:) camp and camp-inhibited cgmp 3', 5'-cyclic phosphodiesterase 10a

SCOPe Domain Sequences for d2y0ja_:

Sequence; same for both SEQRES and ATOM records:

>d2y0ja_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsv
kknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsyl
qkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdl
alyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyae
fwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkac
rdnlsqwekvirge

Timeline for d2y0ja_:

• d2y0ja_ first appeared in SCOPe 2.03
  
• d2y0ja_ appears in SCOPe 2.07