SCOPe 2.03: Domain d2xmza_: 2xmz A:

Lineage for d2xmza_ (2xmz A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (40 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [231572] (1 PDB entry)

8. Domain d2xmza_: 2xmz A: [231573]
   automated match to d1va4a_

Details for d2xmza_

PDB Entry: 2xmz, 1.94 Å

PDB Description: structure of menh from s. aureus

PDB Compounds: (A:) hydrolase, alpha/beta hydrolase fold family

SCOPe Domain Sequences for d2xmza_:

Sequence; same for both SEQRES and ATOM records:

>d2xmza_ c.69.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mthykfyeanvetnqvlvflhgflsdsrtyhnhiekftdnyhvitidlpghgedqssmde
twnfdyittlldrildkykdksitlfgysmggrvalyyainghipisnlilestspgike
eanqlerrlvddarakvldiagielfvndweklplfqsqlelpveiqhqirqqrlsqsph
kmakalrdygtgqmpnlwprlkeikvptlilageydekfvqiakkmanlipnskcklisa
tghtihvedsdefdtmilgflkeeqn

Timeline for d2xmza_:

• d2xmza_ is new in SCOPe 2.03-stable
  
• d2xmza_ appears in SCOPe 2.04
  
• d2xmza_ appears in the current release, SCOPe 2.08