Lineage for d2xmza_ (2xmz A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2903032Species Staphylococcus aureus [TaxId:1280] [231572] (1 PDB entry)
  8. 2903033Domain d2xmza_: 2xmz A: [231573]
    automated match to d1va4a_

Details for d2xmza_

PDB Entry: 2xmz (more details), 1.94 Å

PDB Description: structure of menh from s. aureus
PDB Compounds: (A:) hydrolase, alpha/beta hydrolase fold family

SCOPe Domain Sequences for d2xmza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xmza_ c.69.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mthykfyeanvetnqvlvflhgflsdsrtyhnhiekftdnyhvitidlpghgedqssmde
twnfdyittlldrildkykdksitlfgysmggrvalyyainghipisnlilestspgike
eanqlerrlvddarakvldiagielfvndweklplfqsqlelpveiqhqirqqrlsqsph
kmakalrdygtgqmpnlwprlkeikvptlilageydekfvqiakkmanlipnskcklisa
tghtihvedsdefdtmilgflkeeqn

SCOPe Domain Coordinates for d2xmza_:

Click to download the PDB-style file with coordinates for d2xmza_.
(The format of our PDB-style files is described here.)

Timeline for d2xmza_: