Lineage for d2xgwa_ (2xgw A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2705122Species Streptococcus pyogenes [TaxId:1314] [225749] (3 PDB entries)
  8. 2705125Domain d2xgwa_: 2xgw A: [231570]
    automated match to d2wlaa_
    complexed with cl, gol, sin, zn

Details for d2xgwa_

PDB Entry: 2xgw (more details), 2.1 Å

PDB Description: zinc-bound crystal structure of streptococcus pyogenes dpr
PDB Compounds: (A:) peroxide resistance protein

SCOPe Domain Sequences for d2xgwa_:

Sequence, based on SEQRES records: (download)

>d2xgwa_ a.25.1.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
tlveniyasvthniskkeasknektkavlnqavadlsvaasivhqvhwymrgpgflylhp
kmdelldslnanldevserlitiggapystlaefskhskldeakgtydktvaqhlarlve
vylylsslyqvglditdeegdagtndlftaakteaektiwmlqaergqgpal

Sequence, based on observed residues (ATOM records): (download)

>d2xgwa_ a.25.1.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
tlveniyasvthnsknektkavlnqavadlsvaasivhqvhwymrgpgflylhpkmdell
dslnanldevserlitiggapystlaefskhskldeakgtydktvaqhlarlvevylyls
slyqvglditdeegdagtndlftaakteaektiwmlqaergqgpal

SCOPe Domain Coordinates for d2xgwa_:

Click to download the PDB-style file with coordinates for d2xgwa_.
(The format of our PDB-style files is described here.)

Timeline for d2xgwa_: