![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Magnetospirillum magnetotacticum [TaxId:188] [231564] (2 PDB entries) |
![]() | Domain d2x6ca2: 2x6c A:138-294 [231565] Other proteins in same PDB: d2x6ca1, d2x6ca3 automated match to d1p7ba1 complexed with cl, k, pc, sm |
PDB Entry: 2x6c (more details), 2.7 Å
SCOPe Domain Sequences for d2x6ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x6ca2 b.1.18.0 (A:138-294) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]} ptagvlfssrmvisdfegkptlmmrlanlrieaiieadvhlvlvrseisqegmvfrrfhd ltltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvhar hayscdeiiwgghfvdvfttlpdgrraldlgkfheia
Timeline for d2x6ca2: