Lineage for d2x6ca2 (2x6c A:138-294)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766398Species Magnetospirillum magnetotacticum [TaxId:188] [231564] (2 PDB entries)
  8. 2766399Domain d2x6ca2: 2x6c A:138-294 [231565]
    Other proteins in same PDB: d2x6ca1, d2x6ca3
    automated match to d1p7ba1
    complexed with cl, k, pc, sm

Details for d2x6ca2

PDB Entry: 2x6c (more details), 2.7 Å

PDB Description: Potassium Channel from Magnetospirillum Magnetotacticum
PDB Compounds: (A:) ATP-sensitive inward rectifier potassium channel 10

SCOPe Domain Sequences for d2x6ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x6ca2 b.1.18.0 (A:138-294) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
ptagvlfssrmvisdfegkptlmmrlanlrieaiieadvhlvlvrseisqegmvfrrfhd
ltltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvhar
hayscdeiiwgghfvdvfttlpdgrraldlgkfheia

SCOPe Domain Coordinates for d2x6ca2:

Click to download the PDB-style file with coordinates for d2x6ca2.
(The format of our PDB-style files is described here.)

Timeline for d2x6ca2: