Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) |
Family f.14.1.0: automated matches [231560] (1 protein) not a true family |
Protein automated matches [231561] (2 species) not a true protein |
Species Magnetospirillum magnetotacticum [TaxId:188] [231562] (1 PDB entry) |
Domain d2x6ca1: 2x6c A:12-137 [231563] Other proteins in same PDB: d2x6ca2, d2x6ca3 automated match to d1p7ba2 complexed with cl, k, pc, sm |
PDB Entry: 2x6c (more details), 2.7 Å
SCOPe Domain Sequences for d2x6ca1:
Sequence, based on SEQRES records: (download)
>d2x6ca1 f.14.1.0 (A:12-137) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]} prilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylac gdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasli yarftr
>d2x6ca1 f.14.1.0 (A:12-137) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]} prilnsdgssnitrlghyhdlltvswpvfitlitglylvtnalfalaylagdvienafff svqtmatigygkliptlvtlealcgmlglavaasliyarftr
Timeline for d2x6ca1: