Lineage for d1kcwa6 (1kcw A:892-1040)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1114375Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1114376Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1114921Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 1114948Protein Ceruloplasmin [49559] (1 species)
    consists of 6 domains of this fold
  7. 1114949Species Human (Homo sapiens) [TaxId:9606] [49560] (2 PDB entries)
  8. 1114960Domain d1kcwa6: 1kcw A:892-1040 [23156]
    complexed with cu, nag, o

Details for d1kcwa6

PDB Entry: 1kcw (more details), 3 Å

PDB Description: x-ray crystal structure of human ceruloplasmin at 3.0 angstroms
PDB Compounds: (A:) ceruloplasmin

SCOPe Domain Sequences for d1kcwa6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcwa6 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}
rrklefallflvfdeneswylddniktysdhpekvnkddeefiesnkmhaingrmfgnlq
gltmhvgdevnwylmgmgneidlhtvhfhghsfqykhrgvyssdvfdifpgtyqtlemfp
rtpgiwllhchvtdhihagmettytvlqn

SCOPe Domain Coordinates for d1kcwa6:

Click to download the PDB-style file with coordinates for d1kcwa6.
(The format of our PDB-style files is described here.)

Timeline for d1kcwa6: