| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (41 species) not a true protein |
| Species Xylella fastidiosa [TaxId:160492] [231549] (1 PDB entry) |
| Domain d2x64f2: 2x64 F:78-205 [231559] Other proteins in same PDB: d2x64a1, d2x64b1, d2x64c1, d2x64d1, d2x64e1, d2x64f1 automated match to d4iq1a2 complexed with cl, gsh |
PDB Entry: 2x64 (more details), 2.3 Å
SCOPe Domain Sequences for d2x64f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x64f2 a.45.1.0 (F:78-205) automated matches {Xylella fastidiosa [TaxId: 160492]}
glsgdgslkaraeinrwiafsnsdvhpmywalfggtaylqdpqmiarsqdnarqklrvly
qradahlkhhnwlangqrsgadaylyvtlrwakkvgvdlssldalsaffermeadpgvqa
alqaegli
Timeline for d2x64f2: