SCOPe 2.03: Domain d2x64f2: 2x64 F:78-205

Lineage for d2x64f2 (2x64 F:78-205)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (36 species)
   not a true protein

7. Species Xylella fastidiosa [TaxId:160492] [231549] (1 PDB entry)

8. Domain d2x64f2: 2x64 F:78-205 [231559]
   Other proteins in same PDB: d2x64a1, d2x64b1, d2x64c1, d2x64d1, d2x64e1, d2x64f1
   automated match to d4iq1a2
   complexed with cl, gsh

Details for d2x64f2

PDB Entry: 2x64, 2.3 Å

PDB Description: glutathione-s-transferase from xylella fastidiosa

PDB Compounds: (F:) glutathione-s-transferase

SCOPe Domain Sequences for d2x64f2:

Sequence; same for both SEQRES and ATOM records:

>d2x64f2 a.45.1.0 (F:78-205) automated matches {Xylella fastidiosa [TaxId: 160492]}
glsgdgslkaraeinrwiafsnsdvhpmywalfggtaylqdpqmiarsqdnarqklrvly
qradahlkhhnwlangqrsgadaylyvtlrwakkvgvdlssldalsaffermeadpgvqa
alqaegli

Timeline for d2x64f2:

• d2x64f2 is new in SCOPe 2.03-stable
  
• d2x64f2 appears in SCOPe 2.04
  
• d2x64f2 appears in the current release, SCOPe 2.08