Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Xylella fastidiosa [TaxId:160492] [231546] (1 PDB entry) |
Domain d2x64e1: 2x64 E:1-77 [231556] Other proteins in same PDB: d2x64a2, d2x64b2, d2x64c2, d2x64d2, d2x64e2, d2x64f2 automated match to d4iq1a1 complexed with cl, gsh |
PDB Entry: 2x64 (more details), 2.3 Å
SCOPe Domain Sequences for d2x64e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x64e1 c.47.1.0 (E:1-77) automated matches {Xylella fastidiosa [TaxId: 160492]} mklyimpgacsladhillrwsgssfdlqfldhqsmkapeylalnpsgavpalqvgdwvlt qnaailnyitdiapaer
Timeline for d2x64e1: