Lineage for d2x64e1 (2x64 E:1-77)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1603313Species Xylella fastidiosa [TaxId:160492] [231546] (1 PDB entry)
  8. 1603318Domain d2x64e1: 2x64 E:1-77 [231556]
    Other proteins in same PDB: d2x64a2, d2x64b2, d2x64c2, d2x64d2, d2x64e2, d2x64f2
    automated match to d4iq1a1
    complexed with cl, gsh

Details for d2x64e1

PDB Entry: 2x64 (more details), 2.3 Å

PDB Description: glutathione-s-transferase from xylella fastidiosa
PDB Compounds: (E:) glutathione-s-transferase

SCOPe Domain Sequences for d2x64e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x64e1 c.47.1.0 (E:1-77) automated matches {Xylella fastidiosa [TaxId: 160492]}
mklyimpgacsladhillrwsgssfdlqfldhqsmkapeylalnpsgavpalqvgdwvlt
qnaailnyitdiapaer

SCOPe Domain Coordinates for d2x64e1:

Click to download the PDB-style file with coordinates for d2x64e1.
(The format of our PDB-style files is described here.)

Timeline for d2x64e1: