Lineage for d2x64d2 (2x64 D:78-205)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714335Species Xylella fastidiosa [TaxId:160492] [231549] (1 PDB entry)
  8. 2714339Domain d2x64d2: 2x64 D:78-205 [231555]
    Other proteins in same PDB: d2x64a1, d2x64b1, d2x64c1, d2x64d1, d2x64e1, d2x64f1
    automated match to d4iq1a2
    complexed with cl, gsh

Details for d2x64d2

PDB Entry: 2x64 (more details), 2.3 Å

PDB Description: glutathione-s-transferase from xylella fastidiosa
PDB Compounds: (D:) glutathione-s-transferase

SCOPe Domain Sequences for d2x64d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x64d2 a.45.1.0 (D:78-205) automated matches {Xylella fastidiosa [TaxId: 160492]}
glsgdgslkaraeinrwiafsnsdvhpmywalfggtaylqdpqmiarsqdnarqklrvly
qradahlkhhnwlangqrsgadaylyvtlrwakkvgvdlssldalsaffermeadpgvqa
alqaegli

SCOPe Domain Coordinates for d2x64d2:

Click to download the PDB-style file with coordinates for d2x64d2.
(The format of our PDB-style files is described here.)

Timeline for d2x64d2: