SCOPe 2.08: Domain d2x64d1: 2x64 D:0-77

Lineage for d2x64d1 (2x64 D:0-77)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Xylella fastidiosa [TaxId:160492] [231546] (1 PDB entry)

8. Domain d2x64d1: 2x64 D:0-77 [231554]
   Other proteins in same PDB: d2x64a2, d2x64b2, d2x64c2, d2x64d2, d2x64e2, d2x64f2
   automated match to d4iq1a1
   complexed with cl, gsh

Details for d2x64d1

PDB Entry: 2x64, 2.3 Å

PDB Description: glutathione-s-transferase from xylella fastidiosa

PDB Compounds: (D:) glutathione-s-transferase

SCOPe Domain Sequences for d2x64d1:

Sequence; same for both SEQRES and ATOM records:

>d2x64d1 c.47.1.0 (D:0-77) automated matches {Xylella fastidiosa [TaxId: 160492]}
hmklyimpgacsladhillrwsgssfdlqfldhqsmkapeylalnpsgavpalqvgdwvl
tqnaailnyitdiapaer

Timeline for d2x64d1:

• d2x64d1 first appeared in SCOPe 2.03
  
• d2x64d1 appears in SCOPe 2.07