Lineage for d1kcw_5 (1kcw 706-884)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 56191Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)
  6. 56218Protein Ceruloplasmin [49559] (1 species)
  7. 56219Species Human (Homo sapiens) [TaxId:9606] [49560] (1 PDB entry)
  8. 56224Domain d1kcw_5: 1kcw 706-884 [23155]

Details for d1kcw_5

PDB Entry: 1kcw (more details), 3 Å

PDB Description: x-ray crystal structure of human ceruloplasmin at 3.0 angstroms

SCOP Domain Sequences for d1kcw_5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcw_5 b.6.1.3 (706-884) Ceruloplasmin {Human (Homo sapiens)}
stfylgertyyiaavevewdyspqrewekelhhlqeqnvsnafldkgefyigskykkvvy
rqytdstfrvpverkaeeehlgilgpqlhadvgdkvkiifknmatrpysihahgvqtess
tvtptlpgetltyvwkipersgagtedsacipwayystvdqvkdlysgligplivcrrp

SCOP Domain Coordinates for d1kcw_5:

Click to download the PDB-style file with coordinates for d1kcw_5.
(The format of our PDB-style files is described here.)

Timeline for d1kcw_5: