![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
![]() | Domain d1kcwa4: 1kcw A:554-705 [23154] complexed with cu, nag, o |
PDB Entry: 1kcw (more details), 3 Å
SCOPe Domain Sequences for d1kcwa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kcwa4 b.6.1.3 (A:554-705) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} dvdkefylfptvfdeneslllednirmfttapdqvdkededfqesnkmhsmngfmygnqp gltmckgdsvvwylfsagneadvhgiyfsgntylwrgerrdtanlfpqtsltlhmwpdte gtfnveclttdhytggmkqkytvnqcrrqsed
Timeline for d1kcwa4: