Lineage for d1kcw_4 (1kcw 554-705)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457650Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 457651Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 457981Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 458008Protein Ceruloplasmin [49559] (1 species)
    consists of 6 domains of this fold
  7. 458009Species Human (Homo sapiens) [TaxId:9606] [49560] (1 PDB entry)
  8. 458013Domain d1kcw_4: 1kcw 554-705 [23154]

Details for d1kcw_4

PDB Entry: 1kcw (more details), 3 Å

PDB Description: x-ray crystal structure of human ceruloplasmin at 3.0 angstroms

SCOP Domain Sequences for d1kcw_4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcw_4 b.6.1.3 (554-705) Ceruloplasmin {Human (Homo sapiens)}
dvdkefylfptvfdeneslllednirmfttapdqvdkededfqesnkmhsmngfmygnqp
gltmckgdsvvwylfsagneadvhgiyfsgntylwrgerrdtanlfpqtsltlhmwpdte
gtfnveclttdhytggmkqkytvnqcrrqsed

SCOP Domain Coordinates for d1kcw_4:

Click to download the PDB-style file with coordinates for d1kcw_4.
(The format of our PDB-style files is described here.)

Timeline for d1kcw_4: