Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (31 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [231529] (2 PDB entries) |
Domain d2x1la1: 2x1l A:2-135,A:136-353 [231530] Other proteins in same PDB: d2x1la2, d2x1lb1, d2x1lc1 automated match to d4eg3b1 protein/RNA complex; complexed with 2hp, adn, cxs, met |
PDB Entry: 2x1l (more details), 2.3 Å
SCOPe Domain Sequences for d2x1la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x1la1 c.26.1.0 (A:2-135,A:136-353) automated matches {Mycobacterium smegmatis [TaxId: 246196]} sepfyittaiaypngvphighayeyiatdaiarfkrldgydvryltgtdvhgqkmaetaa kegipaaelarrnsdvfqrlqeklnisfdrfirtsdadhyeaskaiwkrmadagdiylda ykgwysirderfftXenetteqpdgtriatetgapvtwteeqtyffrlsaytdrllalye ehpefigpdarrneivsfvsgglkdlsisrttfdwgvpvpdhpdhvmyvwvdaltnyltg vgfpdtesesfrrywpadlhmigkdiirfhtvywpaflmsaglplpkrifahgwllnrge kmsksignvvdpvnlvdtfgldqvryfllrevpfgqdgsynedaiigrvnadl
Timeline for d2x1la1: