SCOPe 2.03: Domain d2wvje2: 2wvj E:151-191

Lineage for d2wvje2 (2wvj E:151-191)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.0: automated matches [191378] (1 protein)
   not a true family

6. Protein automated matches [190463] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187379] (3 PDB entries)

8. Domain d2wvje2: 2wvj E:151-191 [231527]
   Other proteins in same PDB: d2wvja1, d2wvjb1, d2wvjc1, d2wvjd1, d2wvje1
   automated match to d1xbta2
   complexed with mg, ttp, zn; mutant

Details for d2wvje2

PDB Entry: 2wvj, 2.2 Å

PDB Description: mutation of thr163 to ser in human thymidine kinase shifts the specificity from thymidine towards the nucleoside analogue azidothymidine

PDB Compounds: (E:) Thymidine kinase, cytosolic

SCOPe Domain Sequences for d2wvje2:

Sequence; same for both SEQRES and ATOM records:

>d2wvje2 g.39.1.0 (E:151-191) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avcmecfreaayskrlgtekeveviggadkyhsvcrlcyfk

Timeline for d2wvje2:

• d2wvje2 is new in SCOPe 2.03-stable
  
• d2wvje2 appears in SCOPe 2.04
  
• d2wvje2 appears in the current release, SCOPe 2.08