![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.0: automated matches [191378] (1 protein) not a true family |
![]() | Protein automated matches [190463] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187379] (11 PDB entries) |
![]() | Domain d2wvje2: 2wvj E:151-191 [231527] Other proteins in same PDB: d2wvja1, d2wvjb1, d2wvjc1, d2wvjd1, d2wvje1, d2wvjf1, d2wvjg1, d2wvjh1 automated match to d1xbta2 complexed with mg, ttp, zn; mutant |
PDB Entry: 2wvj (more details), 2.2 Å
SCOPe Domain Sequences for d2wvje2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wvje2 g.39.1.0 (E:151-191) automated matches {Human (Homo sapiens) [TaxId: 9606]} avcmecfreaayskrlgtekeveviggadkyhsvcrlcyfk
Timeline for d2wvje2: