Lineage for d2wvjb2 (2wvj B:151-192)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640848Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 2640849Protein automated matches [190463] (9 species)
    not a true protein
  7. 2640881Species Human (Homo sapiens) [TaxId:9606] [187379] (11 PDB entries)
  8. 2640892Domain d2wvjb2: 2wvj B:151-192 [231520]
    Other proteins in same PDB: d2wvja1, d2wvjb1, d2wvjc1, d2wvjd1, d2wvje1, d2wvjf1, d2wvjg1, d2wvjh1
    automated match to d1xbta2
    complexed with mg, ttp, zn; mutant

Details for d2wvjb2

PDB Entry: 2wvj (more details), 2.2 Å

PDB Description: mutation of thr163 to ser in human thymidine kinase shifts the specificity from thymidine towards the nucleoside analogue azidothymidine
PDB Compounds: (B:) Thymidine kinase, cytosolic

SCOPe Domain Sequences for d2wvjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wvjb2 g.39.1.0 (B:151-192) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avcmecfreaayskrlgtekeveviggadkyhsvcrlcyfkk

SCOPe Domain Coordinates for d2wvjb2:

Click to download the PDB-style file with coordinates for d2wvjb2.
(The format of our PDB-style files is described here.)

Timeline for d2wvjb2: