![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (7 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
![]() | Protein Ceruloplasmin [49559] (1 species) consists of 6 domains of this fold |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49560] (2 PDB entries) |
![]() | Domain d1kcwa2: 1kcw A:193-338 [23152] |
PDB Entry: 1kcw (more details), 3 Å
SCOP Domain Sequences for d1kcwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} hidrefvvmfsvvdenfswyledniktycsepekvdkdnedfqesnrmysvngytfgslp glsmcaedrvkwylfgmgnevdvhaaffhgqaltnknyridtinlfpatlfdaymvaqnp gewmlscqnlnhlkaglqaffqvqec
Timeline for d1kcwa2: