Lineage for d1kcw_2 (1kcw 193-338)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 553581Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 553582Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 553929Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 553956Protein Ceruloplasmin [49559] (1 species)
    consists of 6 domains of this fold
  7. 553957Species Human (Homo sapiens) [TaxId:9606] [49560] (1 PDB entry)
  8. 553959Domain d1kcw_2: 1kcw 193-338 [23152]

Details for d1kcw_2

PDB Entry: 1kcw (more details), 3 Å

PDB Description: x-ray crystal structure of human ceruloplasmin at 3.0 angstroms

SCOP Domain Sequences for d1kcw_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcw_2 b.6.1.3 (193-338) Ceruloplasmin {Human (Homo sapiens)}
hidrefvvmfsvvdenfswyledniktycsepekvdkdnedfqesnrmysvngytfgslp
glsmcaedrvkwylfgmgnevdvhaaffhgqaltnknyridtinlfpatlfdaymvaqnp
gewmlscqnlnhlkaglqaffqvqec

SCOP Domain Coordinates for d1kcw_2:

Click to download the PDB-style file with coordinates for d1kcw_2.
(The format of our PDB-style files is described here.)

Timeline for d1kcw_2: