Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins) N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684) |
Protein automated matches [230352] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [230353] (2 PDB entries) |
Domain d2wvjb1: 2wvj B:18-150 [231519] Other proteins in same PDB: d2wvja2, d2wvjb2, d2wvjc2, d2wvjd2, d2wvje2, d2wvjf2, d2wvjg2, d2wvjh2 automated match to d1xbta1 complexed with mg, ttp, zn; mutant |
PDB Entry: 2wvj (more details), 2.2 Å
SCOPe Domain Sequences for d2wvjb1:
Sequence, based on SEQRES records: (download)
>d2wvjb1 c.37.1.24 (B:18-150) automated matches {Human (Homo sapiens) [TaxId: 9606]} rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtrysssfcthdrntmealp acllrdvaqealgvavigidegqffpdivefceamanagktvivaaldgtfqrkpfgail nlvplaesvvklt
>d2wvjb1 c.37.1.24 (B:18-150) automated matches {Human (Homo sapiens) [TaxId: 9606]} rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtralpacllrdvaqealgv avigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklt
Timeline for d2wvjb1: