Lineage for d2wvjb1 (2wvj B:18-150)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871486Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins)
    N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684)
  6. 2871517Protein automated matches [230352] (1 species)
    not a true protein
  7. 2871518Species Human (Homo sapiens) [TaxId:9606] [230353] (2 PDB entries)
  8. 2871528Domain d2wvjb1: 2wvj B:18-150 [231519]
    Other proteins in same PDB: d2wvja2, d2wvjb2, d2wvjc2, d2wvjd2, d2wvje2, d2wvjf2, d2wvjg2, d2wvjh2
    automated match to d1xbta1
    complexed with mg, ttp, zn; mutant

Details for d2wvjb1

PDB Entry: 2wvj (more details), 2.2 Å

PDB Description: mutation of thr163 to ser in human thymidine kinase shifts the specificity from thymidine towards the nucleoside analogue azidothymidine
PDB Compounds: (B:) Thymidine kinase, cytosolic

SCOPe Domain Sequences for d2wvjb1:

Sequence, based on SEQRES records: (download)

>d2wvjb1 c.37.1.24 (B:18-150) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtrysssfcthdrntmealp
acllrdvaqealgvavigidegqffpdivefceamanagktvivaaldgtfqrkpfgail
nlvplaesvvklt

Sequence, based on observed residues (ATOM records): (download)

>d2wvjb1 c.37.1.24 (B:18-150) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtralpacllrdvaqealgv
avigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklt

SCOPe Domain Coordinates for d2wvjb1:

Click to download the PDB-style file with coordinates for d2wvjb1.
(The format of our PDB-style files is described here.)

Timeline for d2wvjb1: