Lineage for d2wveb1 (2wve B:9-60)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735385Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 1735386Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 1735593Family a.43.1.0: automated matches [230594] (1 protein)
    not a true family
  6. 1735594Protein automated matches [230595] (4 species)
    not a true protein
  7. 1735600Species Helicobacter pylori [TaxId:85962] [230596] (9 PDB entries)
  8. 1735612Domain d2wveb1: 2wve B:9-60 [231517]
    Other proteins in same PDB: d2wvea2, d2wveb2
    automated match to d2bj9a1
    complexed with cit, gol, so4, trs

Details for d2wveb1

PDB Entry: 2wve (more details), 2.3 Å

PDB Description: structural and mechanistic insights into helicobacter pylori nikr function
PDB Compounds: (B:) putative nickel-responsive regulator

SCOPe Domain Sequences for d2wveb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wveb1 a.43.1.0 (B:9-60) automated matches {Helicobacter pylori [TaxId: 85962]}
siirfsvslqqnlldeldnriikngyssrselvrdmireklvednwaednpn

SCOPe Domain Coordinates for d2wveb1:

Click to download the PDB-style file with coordinates for d2wveb1.
(The format of our PDB-style files is described here.)

Timeline for d2wveb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wveb2