SCOPe 2.08: Domain d2wvda2: 2wvd A:61-141

Lineage for d2wvda2 (2wvd A:61-141)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.0: automated matches [227175] (1 protein)
   not a true family

6. Protein automated matches [226892] (5 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [230608] (9 PDB entries)

8. Domain d2wvda2: 2wvd A:61-141 [231512]
   Other proteins in same PDB: d2wvda1, d2wvdb1, d2wvdc1, d2wvdd1
   automated match to d2bj9a2
   complexed with gol, so4

Details for d2wvda2

PDB Entry: 2wvd, 2.65 Å

PDB Description: structural and mechanistic insights into helicobacter pylori nikr function

PDB Compounds: (A:) putative nickel-responsive regulator

SCOPe Domain Sequences for d2wvda2:

Sequence; same for both SEQRES and ATOM records:

>d2wvda2 d.58.18.0 (A:61-141) automated matches {Helicobacter pylori [TaxId: 85962]}
deskiavlvviydhhqrelnqrmidiqhasgthvlstthihmdehncletiilqgnsfei
qrlqleigglrgvkfakltka

Timeline for d2wvda2:

• d2wvda2 first appeared in SCOPe 2.03
  
• d2wvda2 appears in SCOPe 2.07