SCOPe 2.04: Domain d1kcwa1: 1kcw A:1-192

Lineage for d1kcwa1 (1kcw A:1-192)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Ceruloplasmin [49559] (1 species)
   consists of 6 domains of this fold
7. Species Human (Homo sapiens) [TaxId:9606] [49560] (1 PDB entry)

8. Domain d1kcwa1: 1kcw A:1-192 [23151]
   complexed with cu, nag, o

Details for d1kcwa1

PDB Entry: 1kcw, 3 Å

PDB Description: x-ray crystal structure of human ceruloplasmin at 3.0 angstroms

PDB Compounds: (A:) ceruloplasmin

SCOPe Domain Sequences for d1kcwa1:

Sequence; same for both SEQRES and ATOM records:

>d1kcwa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]}
kekhyyigiiettwdyasdhgekklisvdtehsniylqngpdrigrlykkalylqytdet
frttiekpvwlgflgpiikaetgdkvyvhlknlasrpytfhshgityykehegaiypdnt
tdfqraddkvypgeqytymllateeqspgegdgncvtriyhshidapkdiasgligplii
ckkdsldkekek

Timeline for d1kcwa1:

• d1kcwa1 first appeared (with stable ids) in SCOP 1.55, called d1kcw_1
  
• d1kcwa1 appears in SCOPe 2.03
  
• d1kcwa1 appears in SCOPe 2.05
  
• d1kcwa1 appears in the current release, SCOPe 2.08