Lineage for d1kcw_1 (1kcw 1-192)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 106913Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins)
  6. 106940Protein Ceruloplasmin [49559] (1 species)
  7. 106941Species Human (Homo sapiens) [TaxId:9606] [49560] (1 PDB entry)
  8. 106942Domain d1kcw_1: 1kcw 1-192 [23151]

Details for d1kcw_1

PDB Entry: 1kcw (more details), 3 Å

PDB Description: x-ray crystal structure of human ceruloplasmin at 3.0 angstroms

SCOP Domain Sequences for d1kcw_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcw_1 b.6.1.3 (1-192) Ceruloplasmin {Human (Homo sapiens)}
kekhyyigiiettwdyasdhgekklisvdtehsniylqngpdrigrlykkalylqytdet
frttiekpvwlgflgpiikaetgdkvyvhlknlasrpytfhshgityykehegaiypdnt
tdfqraddkvypgeqytymllateeqspgegdgncvtriyhshidapkdiasgligplii
ckkdsldkekek

SCOP Domain Coordinates for d1kcw_1:

Click to download the PDB-style file with coordinates for d1kcw_1.
(The format of our PDB-style files is described here.)

Timeline for d1kcw_1: