Lineage for d2wvbb1 (2wvb B:9-60)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270289Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 1270290Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 1270494Family a.43.1.0: automated matches [230594] (1 protein)
    not a true family
  6. 1270495Protein automated matches [230595] (2 species)
    not a true protein
  7. 1270498Species Helicobacter pylori [TaxId:85962] [230596] (7 PDB entries)
  8. 1270500Domain d2wvbb1: 2wvb B:9-60 [231505]
    Other proteins in same PDB: d2wvba2, d2wvbb2
    automated match to d2bj9a1
    complexed with fmt, gol

Details for d2wvbb1

PDB Entry: 2wvb (more details), 1.9 Å

PDB Description: structural and mechanistic insights into helicobacter pylori nikr function
PDB Compounds: (B:) putative nickel-responsive regulator

SCOPe Domain Sequences for d2wvbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wvbb1 a.43.1.0 (B:9-60) automated matches {Helicobacter pylori [TaxId: 85962]}
siirfsvslqqnlldeldnriikngyssrselvrdmireklvednwaednpn

SCOPe Domain Coordinates for d2wvbb1:

Click to download the PDB-style file with coordinates for d2wvbb1.
(The format of our PDB-style files is described here.)

Timeline for d2wvbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wvbb2