Class a: All alpha proteins [46456] (289 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein automated matches [226970] (6 species) not a true protein |
Species Bacillus cereus [TaxId:1396] [230945] (3 PDB entries) |
Domain d2wv1b2: 2wv1 B:77-198 [231502] Other proteins in same PDB: d2wv1a1, d2wv1a3, d2wv1b1, d2wv1b3 automated match to d2fx0a2 complexed with no3; mutant |
PDB Entry: 2wv1 (more details), 2.3 Å
SCOPe Domain Sequences for d2wv1b2:
Sequence, based on SEQRES records: (download)
>d2wv1b2 a.121.1.1 (B:77-198) automated matches {Bacillus cereus [TaxId: 1396]} fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg ekqgvfhffsinhtihwitsivlfpkfkkfidglvprgsgglvprgsgdlvsriisaltd k
>d2wv1b2 a.121.1.1 (B:77-198) automated matches {Bacillus cereus [TaxId: 1396]} fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg ekqgvfhffsinhtihwitsivlfpkfkkfidglvpgdlvsriisaltdk
Timeline for d2wv1b2: