SCOPe 2.03: Domain d2wv1b2: 2wv1 B:77-198

Lineage for d2wv1b2 (2wv1 B:77-198)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein automated matches [226970] (3 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [230945] (3 PDB entries)

8. Domain d2wv1b2: 2wv1 B:77-198 [231502]
   Other proteins in same PDB: d2wv1a1, d2wv1b1
   automated match to d2fx0a2
   complexed with no3; mutant

Details for d2wv1b2

PDB Entry: 2wv1, 2.3 Å

PDB Description: crystal structure of the hlyiir mutant protein with residues 169-186 substituted by a linker containing two thrombin sites

PDB Compounds: (B:) hemolysin II regulatory protein

SCOPe Domain Sequences for d2wv1b2:

Sequence, based on SEQRES records:

>d2wv1b2 a.121.1.1 (B:77-198) automated matches {Bacillus cereus [TaxId: 1396]}
fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg
ekqgvfhffsinhtihwitsivlfpkfkkfidglvprgsgglvprgsgdlvsriisaltd
k

Sequence, based on observed residues (ATOM records):

>d2wv1b2 a.121.1.1 (B:77-198) automated matches {Bacillus cereus [TaxId: 1396]}
fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg
ekqgvfhffsinhtihwitsivlfpkfkkfidglvpgdlvsriisaltdk

Timeline for d2wv1b2:

• d2wv1b2 is new in SCOPe 2.03-stable
  
• d2wv1b2 appears in SCOPe 2.04
  
• d2wv1b2 appears in the current release, SCOPe 2.08