Lineage for d2wv1a2 (2wv1 A:77-198)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1502122Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 1502123Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 1502124Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 1502402Protein automated matches [226970] (3 species)
    not a true protein
  7. 1502403Species Bacillus cereus [TaxId:1396] [230945] (3 PDB entries)
  8. 1502408Domain d2wv1a2: 2wv1 A:77-198 [231500]
    Other proteins in same PDB: d2wv1a1, d2wv1b1
    automated match to d2fx0a2
    complexed with no3; mutant

Details for d2wv1a2

PDB Entry: 2wv1 (more details), 2.3 Å

PDB Description: crystal structure of the hlyiir mutant protein with residues 169-186 substituted by a linker containing two thrombin sites
PDB Compounds: (A:) hemolysin II regulatory protein

SCOPe Domain Sequences for d2wv1a2:

Sequence, based on SEQRES records: (download)

>d2wv1a2 a.121.1.1 (A:77-198) automated matches {Bacillus cereus [TaxId: 1396]}
fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg
ekqgvfhffsinhtihwitsivlfpkfkkfidglvprgsgglvprgsgdlvsriisaltd
k

Sequence, based on observed residues (ATOM records): (download)

>d2wv1a2 a.121.1.1 (A:77-198) automated matches {Bacillus cereus [TaxId: 1396]}
fnpinalreyltvftthikenpeigtlayeeiikesarlekikpyfigsfeqlkeilqeg
ekqgvfhffsinhtihwitsivlfpkfkkfidglvpsgdlvsriisaltdk

SCOPe Domain Coordinates for d2wv1a2:

Click to download the PDB-style file with coordinates for d2wv1a2.
(The format of our PDB-style files is described here.)

Timeline for d2wv1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wv1a1