SCOPe 2.05: Domain d2wv1a1: 2wv1 A:4-76

Lineage for d2wv1a1 (2wv1 A:4-76)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (16 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [231498] (1 PDB entry)

8. Domain d2wv1a1: 2wv1 A:4-76 [231499]
   Other proteins in same PDB: d2wv1a2, d2wv1b2
   automated match to d2fx0a1
   complexed with no3; mutant

Details for d2wv1a1

PDB Entry: 2wv1, 2.3 Å

PDB Description: crystal structure of the hlyiir mutant protein with residues 169-186 substituted by a linker containing two thrombin sites

PDB Compounds: (A:) hemolysin II regulatory protein

SCOPe Domain Sequences for d2wv1a1:

Sequence, based on SEQRES records:

>d2wv1a1 a.4.1.0 (A:4-76) automated matches {Bacillus cereus [TaxId: 1396]}
sreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkkyg
lanelpnfleknq

Sequence, based on observed residues (ATOM records):

>d2wv1a1 a.4.1.0 (A:4-76) automated matches {Bacillus cereus [TaxId: 1396]}
sreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkkyg
lanlpnfleknq

Timeline for d2wv1a1:

• d2wv1a1 first appeared in SCOPe 2.03
  
• d2wv1a1 appears in SCOPe 2.04
  
• d2wv1a1 appears in SCOPe 2.06
  
• d2wv1a1 appears in the current release, SCOPe 2.08