Lineage for d2wv1a1 (2wv1 A:4-76)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1257872Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1258653Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1258654Protein automated matches [190674] (11 species)
    not a true protein
  7. 1258657Species Bacillus cereus [TaxId:1396] [231498] (1 PDB entry)
  8. 1258658Domain d2wv1a1: 2wv1 A:4-76 [231499]
    Other proteins in same PDB: d2wv1a2, d2wv1b2
    automated match to d2fx0a1
    complexed with no3; mutant

Details for d2wv1a1

PDB Entry: 2wv1 (more details), 2.3 Å

PDB Description: crystal structure of the hlyiir mutant protein with residues 169-186 substituted by a linker containing two thrombin sites
PDB Compounds: (A:) hemolysin II regulatory protein

SCOPe Domain Sequences for d2wv1a1:

Sequence, based on SEQRES records: (download)

>d2wv1a1 a.4.1.0 (A:4-76) automated matches {Bacillus cereus [TaxId: 1396]}
sreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkkyg
lanelpnfleknq

Sequence, based on observed residues (ATOM records): (download)

>d2wv1a1 a.4.1.0 (A:4-76) automated matches {Bacillus cereus [TaxId: 1396]}
sreqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkkyg
lanlpnfleknq

SCOPe Domain Coordinates for d2wv1a1:

Click to download the PDB-style file with coordinates for d2wv1a1.
(The format of our PDB-style files is described here.)

Timeline for d2wv1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wv1a2