Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
Protein automated matches [190674] (25 species) not a true protein |
Species Bacillus cereus [TaxId:1396] [231498] (1 PDB entry) |
Domain d2wv1a1: 2wv1 A:5-76 [231499] Other proteins in same PDB: d2wv1a2, d2wv1a3, d2wv1b2, d2wv1b3 automated match to d2fx0a1 complexed with no3; mutant |
PDB Entry: 2wv1 (more details), 2.3 Å
SCOPe Domain Sequences for d2wv1a1:
Sequence, based on SEQRES records: (download)
>d2wv1a1 a.4.1.0 (A:5-76) automated matches {Bacillus cereus [TaxId: 1396]} reqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkkygl anelpnfleknq
>d2wv1a1 a.4.1.0 (A:5-76) automated matches {Bacillus cereus [TaxId: 1396]} reqtmenilkaakkkfgergyegtsiqeiakeakvnvamasyyfngkenlyyevfkkygl anlpnfleknq
Timeline for d2wv1a1: