![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (22 species) not a true protein |
![]() | Species Bos taurus [TaxId:9913] [231496] (1 PDB entry) |
![]() | Domain d2wtrb2: 2wtr B:176-400 [231497] Other proteins in same PDB: d2wtra1, d2wtra2, d2wtrb1 automated match to d1g4ma2 complexed with ba |
PDB Entry: 2wtr (more details), 2.9 Å
SCOPe Domain Sequences for d2wtrb2:
Sequence, based on SEQRES records: (download)
>d2wtrb2 b.1.18.0 (B:176-400) automated matches {Bos taurus [TaxId: 9913]} erpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisv rqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkh edtnlasstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpk pkeepphrevpehetpvdtnlieldtndddivfedfarqrlkgmk
>d2wtrb2 b.1.18.0 (B:176-400) automated matches {Bos taurus [TaxId: 9913]} erpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrq yadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhed tnlasstllreganreilgiivsykvkvklvvsrassdvavelpftlmhpkpkeepldtn dddivfedfarqrlkgmk
Timeline for d2wtrb2: