SCOPe 2.08: Domain d2wtrb2: 2wtr B:176-400

Lineage for d2wtrb2 (2wtr B:176-400)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [231496] (3 PDB entries)

8. Domain d2wtrb2: 2wtr B:176-400 [231497]
   Other proteins in same PDB: d2wtra1, d2wtra2, d2wtrb1
   automated match to d1g4ma2
   complexed with ba

Details for d2wtrb2

PDB Entry: 2wtr, 2.9 Å

PDB Description: full length arrestin2

PDB Compounds: (B:) beta-arrestin-1

SCOPe Domain Sequences for d2wtrb2:

Sequence, based on SEQRES records:

>d2wtrb2 b.1.18.0 (B:176-400) automated matches {Cow (Bos taurus) [TaxId: 9913]}
erpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisv
rqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkh
edtnlasstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpk
pkeepphrevpehetpvdtnlieldtndddivfedfarqrlkgmk

Sequence, based on observed residues (ATOM records):

>d2wtrb2 b.1.18.0 (B:176-400) automated matches {Cow (Bos taurus) [TaxId: 9913]}
erpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrq
yadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhed
tnlasstllreganreilgiivsykvkvklvvsrassdvavelpftlmhpkpkeepldtn
dddivfedfarqrlkgmk

Timeline for d2wtrb2:

• d2wtrb2 first appeared in SCOPe 2.03
  
• d2wtrb2 appears in SCOPe 2.07