![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (5 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (5 proteins) |
![]() | Protein Laccase [49557] (4 species) consists of three domains of this fold |
![]() | Species Inky cap fungus (Coprinus cinereus) [TaxId:5346] [49558] (2 PDB entries) |
![]() | Domain d1a65a2: 1a65 A:132-303 [23149] |
PDB Entry: 1a65 (more details), 2.23 Å
SCOP Domain Sequences for d1a65a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a65a2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus)} phaalydeddentiitladwyhipapsiqgaaqpdatlingkgryvggpaaelsivnveq gkkyrmrlislscdpnwqfsidgheltiievdgeltephtvdrlqiftgqrysfvldanq pvdnywiraqpnkgrnglagtfangvnsailryagaanadpttsanpnpaql
Timeline for d1a65a2: