Lineage for d2wspa1 (2wsp A:5-356)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083606Family c.1.8.11: Putative alpha-L-fucosidase, catalytic domain [102079] (2 protein domains)
    glycosyl hydrolase family 29; contains additional beta-barrel with a topological similarity to the C-terminal domain of alpha amylases
    automatically mapped to Pfam PF01120
  6. 2083615Protein automated matches [231482] (2 species)
    not a true protein
  7. 2083637Species Thermotoga maritima [TaxId:243274] [231483] (1 PDB entry)
  8. 2083638Domain d2wspa1: 2wsp A:5-356 [231484]
    Other proteins in same PDB: d2wspa2, d2wspb2
    automated match to d1hl9a2
    complexed with fuc, fuy

Details for d2wspa1

PDB Entry: 2wsp (more details), 2.65 Å

PDB Description: thermotoga maritima alpha-l-fucosynthase, tmd224g, in complex with alpha-l-fuc-(1-2)-beta-l-fuc-n3
PDB Compounds: (A:) Alpha-L-fucosidase, putative

SCOPe Domain Sequences for d2wspa1:

Sequence, based on SEQRES records: (download)

>d2wspa1 c.1.8.11 (A:5-356) automated matches {Thermotoga maritima [TaxId: 243274]}
kprykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelgkvpmdawffqnpy
aewyenslrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagakyvip
ttkhhdgfclwgtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrfttep
irypedlsyirpntyeyadyaykqvmelvdlylpdvlwngmgwpekgkedlkylfayyyn
khpegsvndrwgvphwdfktaeyhvnypgdlpgykweftrgiglsfgynrnegpehmlsv
eqlvytlvdvvskggnlllnvgpkgdgtipdlqkerllglgewlrkygdaiy

Sequence, based on observed residues (ATOM records): (download)

>d2wspa1 c.1.8.11 (A:5-356) automated matches {Thermotoga maritima [TaxId: 243274]}
kprykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelgvpmdawffqnpya
ewyenslrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagakyvipt
tkhhdgfclwgtkytdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrfttepi
rypedlsyirpntyeyadyaykqvmelvdlylpdvlwngmgwpekgkedlkylfayyynk
hpegsvndrwgvphwdfktaeylpgykweftrgiglsfgynrnegpehmlsveqlvytlv
dvvskggnlllnvgpkgdgtipdlqkerllglgewlrkygdaiy

SCOPe Domain Coordinates for d2wspa1:

Click to download the PDB-style file with coordinates for d2wspa1.
(The format of our PDB-style files is described here.)

Timeline for d2wspa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wspa2