Lineage for d1a65a1 (1a65 A:1-131)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043852Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2043893Protein Laccase [49557] (5 species)
    consists of three domains of this fold
  7. 2043949Species Inky cap fungus (Coprinus cinereus) [TaxId:5346] [49558] (2 PDB entries)
  8. 2043953Domain d1a65a1: 1a65 A:1-131 [23148]
    complexed with cu, nag, o, pye

Details for d1a65a1

PDB Entry: 1a65 (more details), 2.23 Å

PDB Description: type-2 cu-depleted laccase from coprinus cinereus
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d1a65a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a65a1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]}
qivnsvdtmtltnanvspdgftragilvngvhgplirggkndnfelnvvndldnptmlrp
tsihwhglfqrgtnwadgadgvnqcpispghaflykftpaghagtfwyhshfgtqycdgl
rgpmviyddnd

SCOPe Domain Coordinates for d1a65a1:

Click to download the PDB-style file with coordinates for d1a65a1.
(The format of our PDB-style files is described here.)

Timeline for d1a65a1: