Lineage for d2wqpa2 (2wqp A:282-349)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427209Superfamily b.85.1: AFP III-like domain [51269] (2 families) (S)
    duplication: consists of two structural repeats related by pseudo dyad
  5. 2427290Family b.85.1.0: automated matches [231476] (1 protein)
    not a true family
  6. 2427291Protein automated matches [231477] (2 species)
    not a true protein
  7. 2427295Species Neisseria meningitidis [TaxId:491] [231478] (1 PDB entry)
  8. 2427296Domain d2wqpa2: 2wqp A:282-349 [231479]
    Other proteins in same PDB: d2wqpa1
    automated match to d1xuua1
    complexed with act, edo, lmr, mn, wqp

Details for d2wqpa2

PDB Entry: 2wqp (more details), 1.75 Å

PDB Description: crystal structure of sialic acid synthase neub-inhibitor complex
PDB Compounds: (A:) polysialic acid capsule biosynthesis protein SiaC

SCOPe Domain Sequences for d2wqpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wqpa2 b.85.1.0 (A:282-349) automated matches {Neisseria meningitidis [TaxId: 491]}
ekptkdfafasvvadkdikkgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkga
qikktdie

SCOPe Domain Coordinates for d2wqpa2:

Click to download the PDB-style file with coordinates for d2wqpa2.
(The format of our PDB-style files is described here.)

Timeline for d2wqpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wqpa1