SCOPe 2.03: Domain d2wqpa2: 2wqp A:282-349

Lineage for d2wqpa2 (2wqp A:282-349)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.1: AFP III-like domain [51269] (2 families)
   duplication: consists of two structural repeats related by pseudo dyad

5. Family b.85.1.0: automated matches [231476] (1 protein)
   not a true family

6. Protein automated matches [231477] (2 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:491] [231478] (1 PDB entry)

8. Domain d2wqpa2: 2wqp A:282-349 [231479]
   Other proteins in same PDB: d2wqpa1
   automated match to d1xuua1
   complexed with act, edo, lmr, mn, wqp

Details for d2wqpa2

PDB Entry: 2wqp, 1.75 Å

PDB Description: crystal structure of sialic acid synthase neub-inhibitor complex

PDB Compounds: (A:) polysialic acid capsule biosynthesis protein SiaC

SCOPe Domain Sequences for d2wqpa2:

Sequence; same for both SEQRES and ATOM records:

>d2wqpa2 b.85.1.0 (A:282-349) automated matches {Neisseria meningitidis [TaxId: 491]}
ekptkdfafasvvadkdikkgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkga
qikktdie

Timeline for d2wqpa2:

• d2wqpa2 is new in SCOPe 2.03-stable
  
• d2wqpa2 appears in SCOPe 2.04
  
• d2wqpa2 appears in the current release, SCOPe 2.08