Class b: All beta proteins [48724] (180 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.1: AFP III-like domain [51269] (2 families) duplication: consists of two structural repeats related by pseudo dyad |
Family b.85.1.0: automated matches [231476] (1 protein) not a true family |
Protein automated matches [231477] (2 species) not a true protein |
Species Neisseria meningitidis [TaxId:491] [231478] (1 PDB entry) |
Domain d2wqpa2: 2wqp A:282-349 [231479] Other proteins in same PDB: d2wqpa1 automated match to d1xuua1 complexed with act, edo, lmr, mn, wqp |
PDB Entry: 2wqp (more details), 1.75 Å
SCOPe Domain Sequences for d2wqpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wqpa2 b.85.1.0 (A:282-349) automated matches {Neisseria meningitidis [TaxId: 491]} ekptkdfafasvvadkdikkgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkga qikktdie
Timeline for d2wqpa2: