SCOPe 2.08: Domain d2wqpa1: 2wqp A:2-281

Lineage for d2wqpa1 (2wqp A:2-281)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.6: NeuB-like [110368] (3 proteins)
   Pfam PF03102

6. Protein automated matches [231473] (2 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:491] [231474] (1 PDB entry)

8. Domain d2wqpa1: 2wqp A:2-281 [231475]
   Other proteins in same PDB: d2wqpa2
   automated match to d1xuua2
   complexed with act, edo, lmr, mn, wqp

Details for d2wqpa1

PDB Entry: 2wqp, 1.75 Å

PDB Description: crystal structure of sialic acid synthase neub-inhibitor complex

PDB Compounds: (A:) polysialic acid capsule biosynthesis protein SiaC

SCOPe Domain Sequences for d2wqpa1:

Sequence; same for both SEQRES and ATOM records:

>d2wqpa1 c.1.10.6 (A:2-281) automated matches {Neisseria meningitidis [TaxId: 491]}
qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived
emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistlfsraaalrlq
rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh
ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm
drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiag

Timeline for d2wqpa1:

• d2wqpa1 first appeared in SCOPe 2.03
  
• d2wqpa1 appears in SCOPe 2.07