Lineage for d1aspb3 (1asp B:339-552)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 56191Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins)
  6. 56192Protein Ascorbate oxidase [49555] (1 species)
  7. 56193Species Zucchini (Cucurbita pepo medullosa) [49556] (4 PDB entries)
  8. 56217Domain d1aspb3: 1asp B:339-552 [23147]

Details for d1aspb3

PDB Entry: 1asp (more details), 2.59 Å

PDB Description: x-ray structures and mechanistic implications of three functional derivatives of ascorbate oxidase from zucchini: reduced-, peroxide-, and azide-forms

SCOP Domain Sequences for d1aspb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aspb3 b.6.1.3 (B:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo medullosa)}
ppvkfnrrifllntqnvingyvkwaindvslalpptpylgamkynllhafdqnpppevfp
edydidtpptnektrigngvyqfkigevvdvilqnanmmkenlsethpwhlhghdfwvlg
ygdgkfsaeeesslnlknpplrntvvifpygwtairfvadnpgvwafhchiephlhmgmg
vvfaegvekvgriptkalacggtakslinnpknp

SCOP Domain Coordinates for d1aspb3:

Click to download the PDB-style file with coordinates for d1aspb3.
(The format of our PDB-style files is described here.)

Timeline for d1aspb3: