![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein automated matches [231466] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [231467] (1 PDB entry) |
![]() | Domain d2wp9b1: 2wp9 B:1-106 [231468] Other proteins in same PDB: d2wp9a1, d2wp9a2, d2wp9a3, d2wp9b2, d2wp9c_, d2wp9d_, d2wp9e1, d2wp9e2, d2wp9e3, d2wp9g_, d2wp9h_, d2wp9i1, d2wp9i2, d2wp9i3, d2wp9k_, d2wp9l_ automated match to d1nekb2 complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant |
PDB Entry: 2wp9 (more details), 2.7 Å
SCOPe Domain Sequences for d2wp9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wp9b1 d.15.4.2 (B:1-106) automated matches {Escherichia coli [TaxId: 562]} mrlefsiyrynpdvddaprmqdytleadegrdmmlldaliqlkekdpslsfrrscregvc gsdglnmngknglacitpisalnqpgkkivirplpglpvirdlvvd
Timeline for d2wp9b1: