![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
![]() | Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) ![]() |
![]() | Family d.101.1.0: automated matches [227218] (1 protein) not a true family |
![]() | Protein automated matches [226956] (5 species) not a true protein |
![]() | Species Methanothermobacter thermautotrophicus [TaxId:145262] [225886] (1 PDB entry) |
![]() | Domain d2wnrc2: 2wnr C:188-270 [231461] Other proteins in same PDB: d2wnra1, d2wnrb1, d2wnrc1, d2wnrd1, d2wnre1, d2wnrf1 automated match to d2je6a2 complexed with po4 |
PDB Entry: 2wnr (more details), 2.65 Å
SCOPe Domain Sequences for d2wnrc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wnrc2 d.101.1.0 (C:188-270) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]} pvnrkalmctfakigneivldpsleeediltarisigvteegsicamqkggegpltrddv lkavsiavekvpqlieyldksmt
Timeline for d2wnrc2: